Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Slc12a5 Peptide - N-terminal region

Slc12a5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

KCC2, mKIAA1176

UniProt

Q91V14

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Slc12a5 Rabbit Polyclonal Antibody (orb579018) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_065066

Preservative

Lyophilized powder

AA Sequence

TDCEDGDGGANPGDGNPKESSPFINSTDTEKGREYDGRNMALFEEEMDTS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Cldn19 (NM_001038590) AAV Particle
MR225217A1V 250 µL

Mouse Cldn19 (NM_001038590) AAV Particle

Sign In for Pricing
View Details
Human Plasma kallikrein Recombinant Protein C-6 His Tag
MBS8433161-01 0.05 mg

Human Plasma kallikrein Recombinant Protein C-6 His Tag

Sign In for Pricing
View Details
Human Plasma kallikrein Recombinant Protein C-6 His Tag
MBS8433161-02 5x 0.05 mg

Human Plasma kallikrein Recombinant Protein C-6 His Tag

Sign In for Pricing
View Details
XEN445 5mg
A13150-5 5 mg

XEN445 5mg

Sign In for Pricing
View Details
Human Caspase-14 ELISA Kit (Colorimetric)
NBP2-75021 1 Kit

Human Caspase-14 ELISA Kit (Colorimetric)

Sign In for Pricing
View Details
CYTH4 Antibody
orb1313596-01 30 µL

CYTH4 Antibody

Sign In for Pricing
View Details