Slc12a5 Peptide - N-terminal region
Slc12a5 Peptide - N-terminal region
Product Specifications
Product Name Alternative
KCC2, mKIAA1176
UniProt
Q91V14
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Slc12a5 Rabbit Polyclonal Antibody (orb579018) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_065066
Preservative
Lyophilized powder
AA Sequence
TDCEDGDGGANPGDGNPKESSPFINSTDTEKGREYDGRNMALFEEEMDTS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![(3AR,3a’R,8aS,8a’S) -2,2’- (1-Phenylpropane-2,2-Diyl) Bis (8,8a-Dihydro-3aH-Indeno[1,2-d]Oxazole)](https://cdn.genprice.uk/genprice/uk/genprice2.webp)
OR1008066-01 100 mg
(3AR,3a’R,8aS,8a’S) -2,2’- (1-Phenylpropane-2,2-Diyl) Bis (8,8a-Dihydro-3aH-Indeno[1,2-d]Oxazole)
Sign In for Pricing
View Details OR1008066-02 250 mg
(3AR,3a’R,8aS,8a’S) -2,2’- (1-Phenylpropane-2,2-Diyl) Bis (8,8a-Dihydro-3aH-Indeno[1,2-d]Oxazole)
Sign In for Pricing
View Details OR1008066-03 1 g
(3AR,3a’R,8aS,8a’S) -2,2’- (1-Phenylpropane-2,2-Diyl) Bis (8,8a-Dihydro-3aH-Indeno[1,2-d]Oxazole)
Sign In for Pricing
View Details OR1008066-04 5 g
(3AR,3a’R,8aS,8a’S) -2,2’- (1-Phenylpropane-2,2-Diyl) Bis (8,8a-Dihydro-3aH-Indeno[1,2-d]Oxazole)
Sign In for Pricing
View Details 
MBS2543578-01 0.06 mL
Mouse anti Human B7-H3/CD276 Monoclonal Antibody
Sign In for Pricing
View Details