Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC13A3 Peptide - C-terminal region

SLC13A3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

NADC3, SDCT2

UniProt

A8MPP9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC13A3 Rabbit Polyclonal Antibody (orb330180) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001011554

Preservative

Lyophilized powder

AA Sequence

GLSVWIGGQLHPLENVPPALAVLLITVVIAFFTEFASNTATIIIFLPVLA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pyrrolidinodithiocarbamic Acid Allyl Ester
sc-296160 25 g

Pyrrolidinodithiocarbamic Acid Allyl Ester

Sign In for Pricing
View Details
SKP1 siRNA (Rat)
MBS8239440-01 15 nmol

SKP1 siRNA (Rat)

Sign In for Pricing
View Details
SKP1 siRNA (Rat)
MBS8239440-02 30 nmol

SKP1 siRNA (Rat)

Sign In for Pricing
View Details
SKP1 siRNA (Rat)
MBS8239440-03 5x 30 nmol

SKP1 siRNA (Rat)

Sign In for Pricing
View Details
Bis (2,2,2-trifluoroethyl) itaconate
PC4759-01 1 g

Bis (2,2,2-trifluoroethyl) itaconate

Sign In for Pricing
View Details
Bis (2,2,2-trifluoroethyl) itaconate
PC4759-02 5 g

Bis (2,2,2-trifluoroethyl) itaconate

Sign In for Pricing
View Details