Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC13A3 Peptide - C-terminal region

SLC13A3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

NADC3, SDCT2

UniProt

A8MPP9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC13A3 Rabbit Polyclonal Antibody (orb330180) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001011554

Preservative

Lyophilized powder

AA Sequence

GLSVWIGGQLHPLENVPPALAVLLITVVIAFFTEFASNTATIIIFLPVLA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Cytieratin 7 magnetic nanoparticles, 250 nm
cyto7 1 mL

Anti-Cytieratin 7 magnetic nanoparticles, 250 nm

Sign In for Pricing
View Details
Cathepsin G
MBS635218-01 0.1 mg

Cathepsin G

Sign In for Pricing
View Details
Cathepsin G
MBS635218-02 5x 0.1 mg

Cathepsin G

Sign In for Pricing
View Details
ZNF799 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
51845061 1.0 µg DNA

ZNF799 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Recombinant Bovine Cytochrome b-245 light chain (CYBA)
MBS1258415-01 0.02 mg (E-Coli)

Recombinant Bovine Cytochrome b-245 light chain (CYBA)

Sign In for Pricing
View Details
Recombinant Bovine Cytochrome b-245 light chain (CYBA)
MBS1258415-02 0.1 mg (E-Coli)

Recombinant Bovine Cytochrome b-245 light chain (CYBA)

Sign In for Pricing
View Details