Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Slc15a3 Peptide - C-terminal region

Slc15a3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Ci1, cI-1

UniProt

Q8BPX9

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Slc15a3 Rabbit Polyclonal Antibody (orb579001) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_075531

Preservative

Lyophilized powder

AA Sequence

ILPVMVTLVPYWMVYFQMQSTYVLQGLHLHIPNIFRTNPNISLLLRSDSS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Entpd1 activation kit by CRISPRa
GA200617 1 Kit

Mouse Entpd1 activation kit by CRISPRa

Sign In for Pricing
View Details
CLPSL2 (NM_207409) Human Over-expression Lysate
LC404015 20 µg

CLPSL2 (NM_207409) Human Over-expression Lysate

Sign In for Pricing
View Details
LIPG Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3G7]
TA501000BM 100 µL

LIPG Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3G7]

Sign In for Pricing
View Details
N Cadherin (CDH2) (NM_001792) Human Over-expression Lysate
LC419743 20 µg

N Cadherin (CDH2) (NM_001792) Human Over-expression Lysate

Sign In for Pricing
View Details
THEMIS (NM_001164685) Human Over-expression Lysate
LY431559 100 µg

THEMIS (NM_001164685) Human Over-expression Lysate

Sign In for Pricing
View Details
Rat IgG1 (GL113) Isotype Control for In Vivo Low Endotoxin
ICH2246-50mg 50 mg

Rat IgG1 (GL113) Isotype Control for In Vivo Low Endotoxin

Sign In for Pricing
View Details