Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Slc15a3 Peptide - C-terminal region

Slc15a3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Ci1, cI-1

UniProt

Q8BPX9

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Slc15a3 Rabbit Polyclonal Antibody (orb579001) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_075531

Preservative

Lyophilized powder

AA Sequence

ILPVMVTLVPYWMVYFQMQSTYVLQGLHLHIPNIFRTNPNISLLLRSDSS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF706 (NM_016096) Human Recombinant Protein
TP309807 20 µg

ZNF706 (NM_016096) Human Recombinant Protein

Sign In for Pricing
View Details
Zfp248 Mouse Gene Knockout Kit (CRISPR)
KN519758 1 Kit

Zfp248 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Rab1A Recombinant Rabbit Monoclonal Antibody [PSH03-62]
HA722021 100 µL

Rab1A Recombinant Rabbit Monoclonal Antibody [PSH03-62]

Sign In for Pricing
View Details
Human Scratch 2 (SCRT2) activation kit by CRISPRa
GA113912 1 Kit

Human Scratch 2 (SCRT2) activation kit by CRISPRa

Sign In for Pricing
View Details
JUNB pSer259 Rabbit Polyclonal Antibody
AP02328PU-S 50 µL

JUNB pSer259 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MIR6790 Human qPCR Primer Pair (MI0022635)
HP301391 200 Reactions

MIR6790 Human qPCR Primer Pair (MI0022635)

Sign In for Pricing
View Details