Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Slc22a3 Peptide - middle region

Slc22a3 Peptide - middle region

Product Specifications

Product Name Alternative

EMT, Oct3, Orct3, Slca22a3

UniProt

Q9WTW5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Slc22a3 Rabbit Polyclonal Antibody (orb579026) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_035525

Preservative

Lyophilized powder

AA Sequence

TSSELSCDPLTAFPNRSAPLVSCSGDWRYVETHSTIVSQFDLVCSNAWML

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PIF1 Antibody
A46093-50UL 50 μL

PIF1 Antibody

Sign In for Pricing
View Details
3- (Butylsulfonamido) phenylboronic acid
OR360856 1 Each

3- (Butylsulfonamido) phenylboronic acid

Sign In for Pricing
View Details
Mixing Block
BYQ6614E 1 Unit

Mixing Block

Sign In for Pricing
View Details
Rat Olfactory receptor 5B2 (OR5B2) ELISA Kit
MBS7222876-01 48 Well

Rat Olfactory receptor 5B2 (OR5B2) ELISA Kit

Sign In for Pricing
View Details
Rat Olfactory receptor 5B2 (OR5B2) ELISA Kit
MBS7222876-02 96 Well

Rat Olfactory receptor 5B2 (OR5B2) ELISA Kit

Sign In for Pricing
View Details
Rat Olfactory receptor 5B2 (OR5B2) ELISA Kit
MBS7222876-03 5x 96 Well

Rat Olfactory receptor 5B2 (OR5B2) ELISA Kit

Sign In for Pricing
View Details