Slc25a15 Peptide - N-terminal region
Slc25a15 Peptide - N-terminal region
Product Specifications
Product Name Alternative
D630044L02Rik, Ornt1
UniProt
Q9WVD5
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Slc25a15 Rabbit Polyclonal Antibody (orb578992) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_851842
Preservative
Lyophilized powder
AA Sequence
GTACVLTGQPFDTMKVKMQTFPDLYRGLTDCCLKTYSQVGFRGFYKGTSP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC470276-500 1x 500 µL
TAG-72 / CA72.4 (B72.3), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040043-500 1x 500 µL
P21 / WAF1 (WA-1), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400226-500 1x 500 µL
Pmel17 / gp100 / SILV (NKI-beteb), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details