Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Slc25a27 Peptide - C-terminal region

Slc25a27 Peptide - C-terminal region

Product Specifications

Product Name Alternative

3632410G24Rik, 9430092A03Rik, D530043E16Rik, Ucp4

UniProt

Q9D6D0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Slc25a27 Rabbit Polyclonal Antibody (orb325101) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_082987

Preservative

Lyophilized powder

AA Sequence

EDNISTHGLSSLCSGLVASILGTPADVIKSRIMNQPRDKQGRGLLYKSSA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human RNF149 sgRNA gene knockout kit - Lentiviral human RNF149 sgRNA gene knockout kit (plasmid)
GTR15383843 1 Vial

Lentiviral human RNF149 sgRNA gene knockout kit - Lentiviral human RNF149 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
Lentiviral human C11orf80 sgRNA gene knockout kit - Lentiviral human C11orf80 sgRNA gene knockout kit (100)
GTR15355944 1 Vial

Lentiviral human C11orf80 sgRNA gene knockout kit - Lentiviral human C11orf80 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
METK3 Antibody
orb840941 2 mg

METK3 Antibody

Sign In for Pricing
View Details
Zfp623 Protein Lysate (Mouse) with C-HA Tag
51057034 100 µg

Zfp623 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
K27-linkage specific ubiquitin Recombinant Antibody, PerCP Conjugated
bsm-63007R-PerCP-TR 20 µL

K27-linkage specific ubiquitin Recombinant Antibody, PerCP Conjugated

Sign In for Pricing
View Details
Hemoglobin subunit gamma 2 (HBG2) (NM_000184) Human Over-expression Lysate
LC424880 20 µg

Hemoglobin subunit gamma 2 (HBG2) (NM_000184) Human Over-expression Lysate

Sign In for Pricing
View Details