Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Slc25a27 Peptide - C-terminal region

Slc25a27 Peptide - C-terminal region

Product Specifications

Product Name Alternative

3632410G24Rik, 9430092A03Rik, D530043E16Rik, Ucp4

UniProt

Q9D6D0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Slc25a27 Rabbit Polyclonal Antibody (orb325101) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_082987

Preservative

Lyophilized powder

AA Sequence

EDNISTHGLSSLCSGLVASILGTPADVIKSRIMNQPRDKQGRGLLYKSSA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DARC (ACKR1) (NM_002036) Human Recombinant Protein
TP304680 20 µg

DARC (ACKR1) (NM_002036) Human Recombinant Protein

Sign In for Pricing
View Details
MTC6 Antibody
orb848143 2 mg

MTC6 Antibody

Sign In for Pricing
View Details
Rat Paox Pre-designed siRNA Set B
SI210041B 1 Each

Rat Paox Pre-designed siRNA Set B

Sign In for Pricing
View Details
MOX-1 Lentiviral Activation Particles (m)
sc-421627-LAC 200 µL

MOX-1 Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
Lentiviral human ZBTB38 shRNA (UAS) - Lentiviral human ZBTB38 shRNA (UAS, iRFP) plasmid
GTR15137848 1 Vial

Lentiviral human ZBTB38 shRNA (UAS) - Lentiviral human ZBTB38 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Ronidazole (HRP) discontinued
227141 500 µL

Ronidazole (HRP) discontinued

Sign In for Pricing
View Details