Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Slc25a31 Peptide - middle region

Slc25a31 Peptide - middle region

Product Specifications

Product Name Alternative

1700034J06Rik, Ant4, Sfec

UniProt

Q3V132

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Slc25a31 Rabbit Polyclonal Antibody (orb582235) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_848473

Preservative

Lyophilized powder

AA Sequence

ARTRLGVDIGKGPEQRQFTGLGDCIMKIAKSDGLIGLYQGFGVSVQGIIV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD41 (Azide Free)
C2394-13 100 µg

CD41 (Azide Free)

Sign In for Pricing
View Details
Anti-Human NAXE Polyclonal Antibody
HV343014-01 50 µg

Anti-Human NAXE Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Human NAXE Polyclonal Antibody
HV343014-02 100 µg

Anti-Human NAXE Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Desulfitobacterium hafniense Glycerol-3-phosphate acyltransferase 1 (plsY1), partial
MBS7075423 Inquire

Recombinant Desulfitobacterium hafniense Glycerol-3-phosphate acyltransferase 1 (plsY1), partial

Sign In for Pricing
View Details
NIS Rabbit Polyclonal Antibody (APC)
orb995369 100 µL

NIS Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
LOC688090 (NM_001101017) Rat Tagged ORF Clone Lentiviral Particle
RR202105L4V 200 µL

LOC688090 (NM_001101017) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details