Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Slc25a31 Peptide - middle region

Slc25a31 Peptide - middle region

Product Specifications

Product Name Alternative

1700034J06Rik, Ant4, Sfec

UniProt

Q3V132

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Slc25a31 Rabbit Polyclonal Antibody (orb582235) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_848473

Preservative

Lyophilized powder

AA Sequence

ARTRLGVDIGKGPEQRQFTGLGDCIMKIAKSDGLIGLYQGFGVSVQGIIV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WFS1 (Wolfram Syndrome 1, FLJ51211, WFRS, WFS, Wolframin) (MaxLight 750)
MBS6443401-01 0.1 mL

WFS1 (Wolfram Syndrome 1, FLJ51211, WFRS, WFS, Wolframin) (MaxLight 750)

Sign In for Pricing
View Details
WFS1 (Wolfram Syndrome 1, FLJ51211, WFRS, WFS, Wolframin) (MaxLight 750)
MBS6443401-02 5x 0.1 mL

WFS1 (Wolfram Syndrome 1, FLJ51211, WFRS, WFS, Wolframin) (MaxLight 750)

Sign In for Pricing
View Details
Arhgdia (NM_001007005) Rat Untagged Clone
RN204316 10 µg

Arhgdia (NM_001007005) Rat Untagged Clone

Sign In for Pricing
View Details
GTF2H5 Protein Vector (Rat) (pPB-C-His)
PV271926 500 ng

GTF2H5 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
Recombinant Rat Lecithin Cholesterol Acyltransferase (LCAT)
RPU42493-01 50 µg

Recombinant Rat Lecithin Cholesterol Acyltransferase (LCAT)

Sign In for Pricing
View Details
Recombinant Rat Lecithin Cholesterol Acyltransferase (LCAT)
RPU42493-02 100 µg

Recombinant Rat Lecithin Cholesterol Acyltransferase (LCAT)

Sign In for Pricing
View Details