Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC25A44 Peptide - middle region

SLC25A44 Peptide - middle region

Product Specifications

Product Name Alternative

FLJ90431, KIAA0446, RP11-54H19.3

UniProt

Q96H78

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC25A44 Rabbit Polyclonal Antibody (orb578996) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055470

Preservative

Lyophilized powder

AA Sequence

QLMAEEGPWGLMKGLSARIISATPSTIVIVVGYESLKKLSLRPELVDSRH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCDC106 Polyclonal Antibody
E-AB-14831-01 20 µL

CCDC106 Polyclonal Antibody

Sign In for Pricing
View Details
CCDC106 Polyclonal Antibody
E-AB-14831-02 60 µL

CCDC106 Polyclonal Antibody

Sign In for Pricing
View Details
CCDC106 Polyclonal Antibody
E-AB-14831-03 120 µL

CCDC106 Polyclonal Antibody

Sign In for Pricing
View Details
CCDC106 Polyclonal Antibody
E-AB-14831-04 200 µL

CCDC106 Polyclonal Antibody

Sign In for Pricing
View Details
Human EGFR (Epidermal Growth Factor Receptor) ELISA Kit
E-EL-H0060-01 24 Tests

Human EGFR (Epidermal Growth Factor Receptor) ELISA Kit

Sign In for Pricing
View Details
Human EGFR (Epidermal Growth Factor Receptor) ELISA Kit
E-EL-H0060-02 48 Tests

Human EGFR (Epidermal Growth Factor Receptor) ELISA Kit

Sign In for Pricing
View Details