SLC25A44 Peptide - middle region
SLC25A44 Peptide - middle region
Product Specifications
Product Name Alternative
FLJ90431, KIAA0446, RP11-54H19.3
UniProt
Q96H78
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SLC25A44 Rabbit Polyclonal Antibody (orb578996) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_055470
Preservative
Lyophilized powder
AA Sequence
QLMAEEGPWGLMKGLSARIISATPSTIVIVVGYESLKKLSLRPELVDSRH
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC882483-100 1x 100 µL
Peroxiredoxin 4 (Prognostic Marker for Lung SqCC) (CPTC-PRDX4-2), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
C3100-ADP-01 1 Each
Adapter pack, for 5ml and 7ml (12-13mm) tubes in 15ml rotors, 8/pk.
Sign In for Pricing
View Details C3100-ADP-02 1 Each
Adapter pack, for 5ml and 7ml (12-13mm) tubes in 15ml rotors, 8/pk.
Sign In for Pricing
View Details 
36500-AAT 100 Tests
Screen Quest™ Fluorimetric Glucose Uptake Assay Kit
Sign In for Pricing
View Details 