Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Slc26a2 Peptide - C-terminal region

Slc26a2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Dtd, ST-OB

UniProt

Q62273

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Slc26a2 Rabbit Polyclonal Antibody (orb330337) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_031911

Preservative

Lyophilized powder

AA Sequence

VSMQLSHDPLEVHTIVIDCSAIQFLDTAGIHTLKEVRRDYEAVGIQVLLA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CMTM2 Rabbit Polyclonal Antibody
E53P02913 100 µL

CMTM2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Guanosine 2',3'-Cyclic Monophosphate Sodium Salt
TRC-G838713-25MG 25 mg

Guanosine 2',3'-Cyclic Monophosphate Sodium Salt

Sign In for Pricing
View Details
Mmu-miR-7038-3p miRNA Agomir
CMN1548-01 5 nmol

Mmu-miR-7038-3p miRNA Agomir

Sign In for Pricing
View Details
Mmu-miR-7038-3p miRNA Agomir
CMN1548-02 10 nmol

Mmu-miR-7038-3p miRNA Agomir

Sign In for Pricing
View Details
Mmu-miR-7038-3p miRNA Agomir
CMN1548-03 20 nmol

Mmu-miR-7038-3p miRNA Agomir

Sign In for Pricing
View Details
Lentiviral human KSR1 sgRNA gene knockout kit - Lentiviral human KSR1 sgRNA gene knockout kit (25)
GTR15396852 1 Vial

Lentiviral human KSR1 sgRNA gene knockout kit - Lentiviral human KSR1 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details