Slc26a2 Peptide - C-terminal region
Slc26a2 Peptide - C-terminal region
Product Specifications
Product Name Alternative
Dtd, ST-OB
UniProt
Q62273
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Slc26a2 Rabbit Polyclonal Antibody (orb330337) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_031911
Preservative
Lyophilized powder
AA Sequence
VSMQLSHDPLEVHTIVIDCSAIQFLDTAGIHTLKEVRRDYEAVGIQVLLA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15175097 1 Vial
Lentiviral mouse Ptprk shRNA (UAS) - Lentiviral mouse Ptprk shRNA (UAS) (25)
Sign In for Pricing
View Details 
HCA050U046X25023A 1 Piece/Case:1 Piece/ PACKS:1 PACKS/CASE
SCX HPLC Column,4.6x250mm,5μm,120A
Sign In for Pricing
View Details 
EK2030-carrier-free 96 Well With Removable Strips
Mouse Matrilin-4 ELISA Kit PicoKine®, Carrier-free
Sign In for Pricing
View Details MBS1048790-01 0.02 mg (E-Coli)
Recombinant Rhodobacter sphaeroides N (2)-fixation sustaining protein CowN
Sign In for Pricing
View Details MBS1048790-02 0.1 mg (E-Coli)
Recombinant Rhodobacter sphaeroides N (2)-fixation sustaining protein CowN
Sign In for Pricing
View Details