Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC27A3 Peptide - middle region

SLC27A3 Peptide - middle region

Product Specifications

Product Name Alternative

ACSVL3, FATP3, MGC4365, VLCS-3

UniProt

Q5K4L6

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC27A3 Rabbit Polyclonal Antibody (orb579029) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_077306

Preservative

Lyophilized powder

AA Sequence

PFSLIRYDVTTGEPIRDPQGHCMATSPGEPGLLVAPVSQQSPFLGYAGGP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

E-Cadherin Recombinant Rabbit monoclonal Antibody
HA723564 100 µL

E-Cadherin Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Human C4orf21 (ZGRF1) activation kit by CRISPRa
GA110724 1 Kit

Human C4orf21 (ZGRF1) activation kit by CRISPRa

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Mouse Ly6C Antibody[Monts 1]
E-AB-F1121M-01 50 Tests

Elab Fluor® 647 Anti-Mouse Ly6C Antibody[Monts 1]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Mouse Ly6C Antibody[Monts 1]
E-AB-F1121M-02 100 Tests

Elab Fluor® 647 Anti-Mouse Ly6C Antibody[Monts 1]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Mouse Ly6C Antibody[Monts 1]
E-AB-F1121M-03 2x 100 Tests

Elab Fluor® 647 Anti-Mouse Ly6C Antibody[Monts 1]

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF568 conjugate, 0.1mg/mL
BNC681820-500 1x 500 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details