Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Slc2a12 Peptide - C-terminal region

Slc2a12 Peptide - C-terminal region

Product Specifications

Product Name Alternative

GLUT-12, Glut12

UniProt

Q8BFW9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Slc2a12 Rabbit Polyclonal Antibody (orb576348) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_849265

Preservative

Lyophilized powder

AA Sequence

VLFIPETKGCSLEQISVELAKANYVKNNICFMSHHQEELVPTQLQKRKPQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

POLH 3'UTR Luciferase Stable Cell Line
TU018407 1.0 mL

POLH 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
GLE1 Adenovirus (Mouse)
21596054 1.0 mL

GLE1 Adenovirus (Mouse)

Sign In for Pricing
View Details
CD14 Protein (C-His, Human)
P513860 100 µg

CD14 Protein (C-His, Human)

Sign In for Pricing
View Details
Rat Calpain ELISA Kit
MBS3807891-01 48 Well

Rat Calpain ELISA Kit

Sign In for Pricing
View Details
Rat Calpain ELISA Kit
MBS3807891-02 96 Well

Rat Calpain ELISA Kit

Sign In for Pricing
View Details
Rat Calpain ELISA Kit
MBS3807891-03 5x 96 Well

Rat Calpain ELISA Kit

Sign In for Pricing
View Details