Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC30A3 Peptide - middle region

SLC30A3 Peptide - middle region

Product Specifications

Product Name Alternative

ZNT3

UniProt

Q99726

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC30A3 Rabbit Polyclonal Antibody (orb578961) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003450

Preservative

Lyophilized powder

AA Sequence

AMLLTASIAVCANLLMAFVLHQAGPPHSHGSRGAEYAPLEEGPEEPLPLG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRIM31 Antibody (Biotin)
KB-13144-01 50 μL

TRIM31 Antibody (Biotin)

Sign In for Pricing
View Details
TRIM31 Antibody (Biotin)
KB-13144-02 100 µL

TRIM31 Antibody (Biotin)

Sign In for Pricing
View Details
TRIM31 Antibody (Biotin)
KB-13144-03 1 mL

TRIM31 Antibody (Biotin)

Sign In for Pricing
View Details
Griffonia simplicifolia Gel -GS-II- Immobilized Lectin
A-2402-2 2 mL

Griffonia simplicifolia Gel -GS-II- Immobilized Lectin

Sign In for Pricing
View Details
Pigment Yellow 83 (Technical Grade)
TRC-P437815-1G 1 g

Pigment Yellow 83 (Technical Grade)

Sign In for Pricing
View Details
EBLN2 Mouse Monoclonal Antibody [Clone ID: OTI2D5]
CF808871 100 µg

EBLN2 Mouse Monoclonal Antibody [Clone ID: OTI2D5]

Sign In for Pricing
View Details