Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC35E2A Peptide - middle region

SLC35E2A Peptide - middle region

Product Specifications

Product Name Alternative

SLC35E2

UniProt

Q5CZA4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC35E2A Rabbit Polyclonal Antibody (orb579075) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_878258

Preservative

Lyophilized powder

AA Sequence

AAASDRRSPVPPSERHGVRPHGENLPGDFQVPQALHRVALSMALPCPMLP

More Discoveries

Explore Other Products

Browse additional items from our catalog

PON2 (h) -PR
sc-62838-PR 10 µM - 20 µL

PON2 (h) -PR

Sign In for Pricing
View Details
PLCB1, CT (PLCB1, KIAA0581, 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1, PLC-154, Phosphoinositide phospholipase C-beta-1, Phospholipase C-I, Phospholipase C-beta-1) (APC)
MBS6334675-01 0.2 mL

PLCB1, CT (PLCB1, KIAA0581, 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1, PLC-154, Phosphoinositide phospholipase C-beta-1, Phospholipase C-I, Phospholipase C-beta-1) (APC)

Sign In for Pricing
View Details
PLCB1, CT (PLCB1, KIAA0581, 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1, PLC-154, Phosphoinositide phospholipase C-beta-1, Phospholipase C-I, Phospholipase C-beta-1) (APC)
MBS6334675-02 5x 0.2 mL

PLCB1, CT (PLCB1, KIAA0581, 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1, PLC-154, Phosphoinositide phospholipase C-beta-1, Phospholipase C-I, Phospholipase C-beta-1) (APC)

Sign In for Pricing
View Details
Rat Annexin A5 (ANXA5) ELISA Kit
DLR-ANXA5-Ra-96T 96 Tests

Rat Annexin A5 (ANXA5) ELISA Kit

Sign In for Pricing
View Details
(3R) -3-Amino-4,4-dimethylpentanoic acid hydrochloride
WLD20711 2.5 g

(3R) -3-Amino-4,4-dimethylpentanoic acid hydrochloride

Sign In for Pricing
View Details
EIF4A3 Antibody
E047100 100 µg -100 µL

EIF4A3 Antibody

Sign In for Pricing
View Details