Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Slc35f3 Peptide - C-terminal region

Slc35f3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

B230375D17Rik, MGC141263, MGC141264

UniProt

Q1LZI2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Slc35f3 Rabbit Polyclonal Antibody (orb579065) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_780643

Preservative

Lyophilized powder

AA Sequence

IGLGFLLLLLPEEWDVWLIKLLTRLKVRKKEETAESSGDLGTGPQSRSRR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GCNT3 Polyclonal Antibody
RA25264-01 50 µL

GCNT3 Polyclonal Antibody

Sign In for Pricing
View Details
GCNT3 Polyclonal Antibody
RA25264-02 100 µL

GCNT3 Polyclonal Antibody

Sign In for Pricing
View Details
CHAC1 Mouse Monoclonal Antibody [Clone ID: OTI1E2]
CF507052 100 µg

CHAC1 Mouse Monoclonal Antibody [Clone ID: OTI1E2]

Sign In for Pricing
View Details
Nebulin (1F4)
sc-293370 100 µg/mL

Nebulin (1F4)

Sign In for Pricing
View Details
Recombinant Mouse NEU4 Protein, His (Fc)-Avi-tagged
NEU4-6019M 50 µg

Recombinant Mouse NEU4 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Lentiviral human SEC63 shRNA (UAS) - Lentiviral human SEC63 shRNA (UAS, RFP) (25)
GTR15337538 1 Vial

Lentiviral human SEC63 shRNA (UAS) - Lentiviral human SEC63 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details