Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Slc35f3 Peptide - C-terminal region

Slc35f3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

B230375D17Rik, MGC141263, MGC141264

UniProt

Q1LZI2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Slc35f3 Rabbit Polyclonal Antibody (orb579065) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_780643

Preservative

Lyophilized powder

AA Sequence

IGLGFLLLLLPEEWDVWLIKLLTRLKVRKKEETAESSGDLGTGPQSRSRR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDC5L (NM_001253) Human Tagged Lenti ORF Clone
RC201702L2 10 µg

CDC5L (NM_001253) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
MICB Antibody
orb1326204 100 µg

MICB Antibody

Sign In for Pricing
View Details
Mouse Monoclonal VEGF R3/Flt-4 Antibody (MM0003-7G63) [DyLight 755]
NB110-60968IR 0.1 mL

Mouse Monoclonal VEGF R3/Flt-4 Antibody (MM0003-7G63) [DyLight 755]

Sign In for Pricing
View Details
Anti-LAMC2 Antibody Picoband®, Carrier-free
A03214-carrier-free 100 µg/Vial

Anti-LAMC2 Antibody Picoband®, Carrier-free

Sign In for Pricing
View Details
ERO1LB Polyclonal Antibody
A72720-050 50 µL

ERO1LB Polyclonal Antibody

Sign In for Pricing
View Details
XDP
NU-601L 5x 100 µL

XDP

Sign In for Pricing
View Details