Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Slc37a2 Peptide - middle region

Slc37a2 Peptide - middle region

Product Specifications

Product Name Alternative

G3PP, Slc37a1, cI-2, ci2

UniProt

Q9WU81

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Slc37a2 Rabbit Polyclonal Antibody (orb579077) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_064654

Preservative

Lyophilized powder

AA Sequence

FSLCLLFAKLVSYTFLYWLPLYIFNVAHFSAKEAGDLSTLFDVGGIIGGI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine 6 phosphofructokinase, liver type (PFKL) ELISA kit
GTR10440137 96 Well

Porcine 6 phosphofructokinase, liver type (PFKL) ELISA kit

Sign In for Pricing
View Details
anti-Autophage-related genes 8 (ATG8)
AR06-PA0001 100 ul

anti-Autophage-related genes 8 (ATG8)

Sign In for Pricing
View Details
Anti-PTN Rabbit pAb
GB113703-50 50 μL

Anti-PTN Rabbit pAb

Sign In for Pricing
View Details
MTAP Rabbit Polyclonal Antibody (HRP)
orb2114204 100 µL

MTAP Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
CUBN ORF Vector (Human) (pORF)
17132011 1.0 µg DNA

CUBN ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Plzf Rabbit Polyclonal Antibody (BF750)
orb1600547 100 µL

Plzf Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details