Slc37a2 Peptide - middle region
Slc37a2 Peptide - middle region
Product Specifications
Product Name Alternative
G3PP, Slc37a1, cI-2, ci2
UniProt
Q9WU81
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Slc37a2 Rabbit Polyclonal Antibody (orb579077) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_064654
Preservative
Lyophilized powder
AA Sequence
FSLCLLFAKLVSYTFLYWLPLYIFNVAHFSAKEAGDLSTLFDVGGIIGGI
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
K7068304 1.0 µg DNA
Ltbp3 sgRNA CRISPR Lentivector (Rat) (Target 3)
Sign In for Pricing
View Details 
MBS6315956-01 0.2 mL
LHFPL5, CT (LHFPL5, TMHS, Tetraspan membrane protein of hair cell stereocilia, Lipoma HMGIC fusion partner-like 5 protein) (Biotin)
Sign In for Pricing
View Details MBS6315956-02 5x 0.2 mL
LHFPL5, CT (LHFPL5, TMHS, Tetraspan membrane protein of hair cell stereocilia, Lipoma HMGIC fusion partner-like 5 protein) (Biotin)
Sign In for Pricing
View Details 