Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC39A9 Peptide - middle region

SLC39A9 Peptide - middle region

Product Specifications

Product Name Alternative

FLJ11274, MGC74989, ZIP9, ZIP-9

UniProt

Q9NUM3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC39A9 Rabbit Polyclonal Antibody (orb579010) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060845

Preservative

Lyophilized powder

AA Sequence

YIGVSLVLGFVFMLLVDQIGNSHVHSTDDPEAARSSNSKITTTLGLVVHA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KRAS (16U12) Rabbit Monoclonal Antibody
E28M7338 100 µL

KRAS (16U12) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
GDX Syringe Filter 0.2um PTFE 13mm
FIL2552 1500 / PCK

GDX Syringe Filter 0.2um PTFE 13mm

Sign In for Pricing
View Details
ITK Rabbit mAb
F1465-20uL 20 µL

ITK Rabbit mAb

Sign In for Pricing
View Details
SUV39H1 AAV Vector (Mouse) (CMV)
45911104 1 µg

SUV39H1 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
Carm1 (NM_153141) Mouse Untagged Clone
MC219264 10 µg

Carm1 (NM_153141) Mouse Untagged Clone

Sign In for Pricing
View Details
KIAA1432 Protein Vector (Human) (pPM-C-His)
PV088957 500 ng

KIAA1432 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details