Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC40A1 Peptide - middle region

SLC40A1 Peptide - middle region

Product Specifications

Product Name Alternative

FPN1, HFE4, IREG1, MST079, MSTP079, MTP1, SLC11A3

UniProt

Q9NP59

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC40A1 Rabbit Polyclonal Antibody (orb578995) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055400

Preservative

Lyophilized powder

AA Sequence

GSPLDLSVSPFEDIRSRFIQGESITPTKIPEITTEIYMSNGSNSANIVPE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ramp1 Mouse Gene Knockout Kit (CRISPR)
KN514450 1 Kit

Ramp1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Col24a1 activation kit by CRISPRa
GA208807 1 Kit

Mouse Col24a1 activation kit by CRISPRa

Sign In for Pricing
View Details
Anti-NFKB3
Y058181 100 µL

Anti-NFKB3

Sign In for Pricing
View Details
MBNL1 (NM_207295) Human Over-expression Lysate
LC404078 20 µg

MBNL1 (NM_207295) Human Over-expression Lysate

Sign In for Pricing
View Details
Penconazole-d7
TRC-P221803-2.5MG 2.5 mg

Penconazole-d7

Sign In for Pricing
View Details
Human NECAB1 activation kit by CRISPRa
GA112003 1 Kit

Human NECAB1 activation kit by CRISPRa

Sign In for Pricing
View Details