Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC40A1 Peptide - middle region

SLC40A1 Peptide - middle region

Product Specifications

Product Name Alternative

FPN1, HFE4, IREG1, MST079, MSTP079, MTP1, SLC11A3

UniProt

Q9NP59

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC40A1 Rabbit Polyclonal Antibody (orb578995) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055400

Preservative

Lyophilized powder

AA Sequence

GSPLDLSVSPFEDIRSRFIQGESITPTKIPEITTEIYMSNGSNSANIVPE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Eosinophil Peroxidase (EPO104), 1mg/mL
BNUM0104-50 1x 50 µL

Eosinophil Peroxidase (EPO104), 1mg/mL

Sign In for Pricing
View Details
MAPK6/ERK3 Recombinant Rabbit Monoclonal Antibody [PSH03-39]
HA721984 100 µL

MAPK6/ERK3 Recombinant Rabbit Monoclonal Antibody [PSH03-39]

Sign In for Pricing
View Details
PSMD2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1D1]
TA503229BM 100 µL

PSMD2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1D1]

Sign In for Pricing
View Details
Frozen Tissue Sections, Small intestine
CS626428 5x 5 µm

Frozen Tissue Sections, Small intestine

Sign In for Pricing
View Details
SOX4 (Master Regulator of Epithelial-Mesenchymal Transition) (SOX4/2540), 0.2mg/mL
BNUB2540-100 1x 100 µL

SOX4 (Master Regulator of Epithelial-Mesenchymal Transition) (SOX4/2540), 0.2mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (N-Terminal) (Pituitary Marker) (r57), 0.2mg/mL
BNUB1380-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (N-Terminal) (Pituitary Marker) (r57), 0.2mg/mL

Sign In for Pricing
View Details