SLC4A5 Peptide - N-terminal region
SLC4A5 Peptide - N-terminal region
Product Specifications
Product Name Alternative
MGC129662, NBC4
UniProt
Q9BY07
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SLC4A5 Rabbit Polyclonal Antibody (orb579022) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_067019
Preservative
Lyophilized powder
AA Sequence
AVDLKSFKNNLVDIIQQNKERWKELAAQGESDLHKNSEDLVNAEEKHDET
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15156854 1 Vial
Lentiviral human PDCD11 shRNA (UAS) - Lentiviral human PDCD11 shRNA (UAS, iRFP) (25)
Sign In for Pricing
View Details 
MBS606941-01 0.02 mL
Acetyl-Coenzyme A Synthetase, Cytoplasmic (Acetyl-CoA Synthetase, AceCS1, AceCS, ACS, ACSA, Acyl-CoA Synthetase Short-chain Family Member 2, ACAS2, ACSS2, Acetate-CoA Ligase, Acyl-activating Enzyme, dJ1161H23.1, DKFZp762G026)
Sign In for Pricing
View Details MBS606941-02 0.1 mL
Acetyl-Coenzyme A Synthetase, Cytoplasmic (Acetyl-CoA Synthetase, AceCS1, AceCS, ACS, ACSA, Acyl-CoA Synthetase Short-chain Family Member 2, ACAS2, ACSS2, Acetate-CoA Ligase, Acyl-activating Enzyme, dJ1161H23.1, DKFZp762G026)
Sign In for Pricing
View Details MBS606941-03 5x 0.1 mL
Acetyl-Coenzyme A Synthetase, Cytoplasmic (Acetyl-CoA Synthetase, AceCS1, AceCS, ACS, ACSA, Acyl-CoA Synthetase Short-chain Family Member 2, ACAS2, ACSS2, Acetate-CoA Ligase, Acyl-activating Enzyme, dJ1161H23.1, DKFZp762G026)
Sign In for Pricing
View Details 
126458-HRP 100 µL
ESD (S-formylglutathione Hydrolase, FGH, Esterase D) (HRP)
Sign In for Pricing
View Details QP7292-ec-10ug 10ug
Recombinant C. trachomatis outer membrane porin Protein, His-SUMO, E.coli-10ug
Sign In for Pricing
View Details