Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC5A5 Peptide - N-terminal region

SLC5A5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

NIS, TDH1

UniProt

Q92911

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC5A5 Rabbit Polyclonal Antibody (orb325092) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000444

Preservative

Lyophilized powder

AA Sequence

TAVGGMKAVVWTDVFQVVVMLSGFWVVLARGVMLVGGPRQVLTLAQNHSR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pro-Epidermal Growth Factor (EGF) Antibody
abx377182-01 50 µg

Pro-Epidermal Growth Factor (EGF) Antibody

Sign In for Pricing
View Details
Pro-Epidermal Growth Factor (EGF) Antibody
abx377182-02 100 µg

Pro-Epidermal Growth Factor (EGF) Antibody

Sign In for Pricing
View Details
3- (3-bromo-2,6-difluorophenyl) pentan-3-ol
PC1023941-01 250 mg

3- (3-bromo-2,6-difluorophenyl) pentan-3-ol

Sign In for Pricing
View Details
3- (3-bromo-2,6-difluorophenyl) pentan-3-ol
PC1023941-02 500 mg

3- (3-bromo-2,6-difluorophenyl) pentan-3-ol

Sign In for Pricing
View Details
3- (3-bromo-2,6-difluorophenyl) pentan-3-ol
PC1023941-03 1 g

3- (3-bromo-2,6-difluorophenyl) pentan-3-ol

Sign In for Pricing
View Details
3- (3-bromo-2,6-difluorophenyl) pentan-3-ol
PC1023941-04 5 g

3- (3-bromo-2,6-difluorophenyl) pentan-3-ol

Sign In for Pricing
View Details