Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC5A5 Peptide - N-terminal region

SLC5A5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

NIS, TDH1

UniProt

Q92911

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC5A5 Rabbit Polyclonal Antibody (orb325092) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000444

Preservative

Lyophilized powder

AA Sequence

TAVGGMKAVVWTDVFQVVVMLSGFWVVLARGVMLVGGPRQVLTLAQNHSR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZGPAT (NM_001083113) Human Tagged ORF Clone Lentiviral Particle
RC207439L3V 200 µL

ZGPAT (NM_001083113) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Recombinant Human EYA2 Protein
ARP2062-01 10 µg

Recombinant Human EYA2 Protein

Sign In for Pricing
View Details
Recombinant Human EYA2 Protein
ARP2062-02 50 µg

Recombinant Human EYA2 Protein

Sign In for Pricing
View Details
Recombinant Human EYA2 Protein
ARP2062-03 100 µg

Recombinant Human EYA2 Protein

Sign In for Pricing
View Details
Recombinant Human EYA2 Protein
ARP2062-04 1 mg

Recombinant Human EYA2 Protein

Sign In for Pricing
View Details
Anti-TRPV5 antibody
STJ191548 200 µl

Anti-TRPV5 antibody

Sign In for Pricing
View Details