Slc6a15 Peptide - middle region
Slc6a15 Peptide - middle region
Product Specifications
Product Name Alternative
AA536730, AI326450, AI326451, v7-3
UniProt
Q8BG16
Field of Research
Neuroscience
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Slc6a15 Rabbit Polyclonal Antibody (orb579073) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_780537
Preservative
Lyophilized powder
AA Sequence
VEDYRLVYDIIQKVKEEEFAVLHLNACQIEDELNKAVQGTGLAFIAFTEA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
bs-10134R-APC-Cy7 100 µL
Phospho-AKT1 (Ser473 + Tyr474) Polyclonal Antibody, APC-Cy7 Conjugated
Sign In for Pricing
View Details 
MBS141514-01 0.01 mg
Recombinant Human Cytotoxic T-Lymphocyte Associated Antigen-4, igG-His Tag, Active
Sign In for Pricing
View Details MBS141514-02 0.05 mg
Recombinant Human Cytotoxic T-Lymphocyte Associated Antigen-4, igG-His Tag, Active
Sign In for Pricing
View Details MBS141514-03 1 mg
Recombinant Human Cytotoxic T-Lymphocyte Associated Antigen-4, igG-His Tag, Active
Sign In for Pricing
View Details MBS141514-04 5x 1 mg
Recombinant Human Cytotoxic T-Lymphocyte Associated Antigen-4, igG-His Tag, Active
Sign In for Pricing
View Details 