Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC6A15 Peptide - middle region

SLC6A15 Peptide - middle region

Product Specifications

Product Name Alternative

DKFZp761I0921, FLJ10316, MGC87066, NTT73, V7-3, hv7-3, SBAT1

UniProt

Q9H2J7

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC6A15 Rabbit Polyclonal Antibody (orb579074) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_877499

Preservative

Lyophilized powder

AA Sequence

YISPLMLLSLLIASVVNMGLSPPGYNAWIEDKASEEFLSYPTWGLVVCVS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARP2 Recombinant Antibody, APC-Cy5.5 Conjugated
bsm-62309R-APC-Cy5.5 100 µL

ARP2 Recombinant Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details
OSR2 (NM_001142462) Human Tagged ORF Clone
RC227535 10 µg

OSR2 (NM_001142462) Human Tagged ORF Clone

Sign In for Pricing
View Details
CCBL1 Polyclonal Antibody
A71673-100 100 µL

CCBL1 Polyclonal Antibody

Sign In for Pricing
View Details
Rat diacyl glycerol (DAG/DG) ELISA Kit
201-11-1708 96 Tests

Rat diacyl glycerol (DAG/DG) ELISA Kit

Sign In for Pricing
View Details
DIDO1 Antibody
MBS9505799-01 0.05 mL

DIDO1 Antibody

Sign In for Pricing
View Details
DIDO1 Antibody
MBS9505799-02 0.1 mL

DIDO1 Antibody

Sign In for Pricing
View Details