Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC6A15 Peptide - middle region

SLC6A15 Peptide - middle region

Product Specifications

Product Name Alternative

DKFZp761I0921, FLJ10316, MGC87066, NTT73, V7-3, hv7-3, SBAT1

UniProt

Q9H2J7

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC6A15 Rabbit Polyclonal Antibody (orb579074) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_877499

Preservative

Lyophilized powder

AA Sequence

YISPLMLLSLLIASVVNMGLSPPGYNAWIEDKASEEFLSYPTWGLVVCVS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FBXO43 sgRNA CRISPR Lentivector (Human) (Target 1)
K0766702 1.0 µg DNA

FBXO43 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Rabbit Polyclonal Symplekin Antibody [DyLight 594]
NB100-74591DL594 0.1 mL

Rabbit Polyclonal Symplekin Antibody [DyLight 594]

Sign In for Pricing
View Details
POPDC2 Human shRNA Lentiviral Particle (Locus ID 64091)
TL302363V 500 µL Each

POPDC2 Human shRNA Lentiviral Particle (Locus ID 64091)

Sign In for Pricing
View Details
USP11 Antibody
35115-01 50 µL

USP11 Antibody

Sign In for Pricing
View Details
USP11 Antibody
35115-02 100 µL

USP11 Antibody

Sign In for Pricing
View Details
Rat Ubiquitin-Associated and SH3 Domain-Containing Protein B (UBASH3B) ELISA Kit
MBS9396112-01 48 Well

Rat Ubiquitin-Associated and SH3 Domain-Containing Protein B (UBASH3B) ELISA Kit

Sign In for Pricing
View Details