Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC6A3 Peptide - N-terminal region

SLC6A3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DAT, DAT1

UniProt

Q01959

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC6A3 Rabbit Polyclonal Antibody (orb330342) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001035

Preservative

Lyophilized powder

AA Sequence

HCNNSWNSPNCSDAHPGDSSGDSSGLNDTFGTTPAAEYFERGVLHLHQSH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RGD1307067 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
66811156 3x 1.0 µg DNA

RGD1307067 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
Rabbit Polyclonal HISPPD2A Antibody [Alexa Fluor 532]
NBP2-44293AF532 0.1 mL

Rabbit Polyclonal HISPPD2A Antibody [Alexa Fluor 532]

Sign In for Pricing
View Details
Trpm5 (NM_001191896) Rat Tagged ORF Clone
RR217513 10 µg

Trpm5 (NM_001191896) Rat Tagged ORF Clone

Sign In for Pricing
View Details
INHBE Protein Vector (Rat) (pPM-C-His)
PV274733 500 ng

INHBE Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
Anti-Collagen alpha-1 (XX) chain COL20A1 Antibody
A14855-2 100 µL

Anti-Collagen alpha-1 (XX) chain COL20A1 Antibody

Sign In for Pricing
View Details
Annexin A1 Rabbit Polyclonal Antibody (BF647)
orb1574673 100 µL

Annexin A1 Rabbit Polyclonal Antibody (BF647)

Sign In for Pricing
View Details