Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC6A3 Peptide - N-terminal region

SLC6A3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DAT, DAT1

UniProt

Q01959

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC6A3 Rabbit Polyclonal Antibody (orb330342) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001035

Preservative

Lyophilized powder

AA Sequence

HCNNSWNSPNCSDAHPGDSSGDSSGLNDTFGTTPAAEYFERGVLHLHQSH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Syt7 (NM_173067) Mouse Tagged ORF Clone
MG222156 10 µg

Syt7 (NM_173067) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
TRNAV6 Protein Vector (Human) (pPB-C-His)
PV140514 500 ng

TRNAV6 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to A Disintegrin And Metalloproteinase With Thrombospondin 7 (ADAMTS7)
MBS2061369-01 0.1 mL

APC-Linked Polyclonal Antibody to A Disintegrin And Metalloproteinase With Thrombospondin 7 (ADAMTS7)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to A Disintegrin And Metalloproteinase With Thrombospondin 7 (ADAMTS7)
MBS2061369-02 0.2 mL

APC-Linked Polyclonal Antibody to A Disintegrin And Metalloproteinase With Thrombospondin 7 (ADAMTS7)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to A Disintegrin And Metalloproteinase With Thrombospondin 7 (ADAMTS7)
MBS2061369-03 0.5 mL

APC-Linked Polyclonal Antibody to A Disintegrin And Metalloproteinase With Thrombospondin 7 (ADAMTS7)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to A Disintegrin And Metalloproteinase With Thrombospondin 7 (ADAMTS7)
MBS2061369-04 1 mL

APC-Linked Polyclonal Antibody to A Disintegrin And Metalloproteinase With Thrombospondin 7 (ADAMTS7)

Sign In for Pricing
View Details