Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Slc7a3 Peptide - middle region

Slc7a3 Peptide - middle region

Product Specifications

Product Name Alternative

Atrc3, CAT3, SLC7A1, SLC7A2

UniProt

P70423

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Slc7a3 Rabbit Polyclonal Antibody (orb578935) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_031541

Preservative

Lyophilized powder

AA Sequence

RAWSSAFDNLIGNHISRTLKGTILLKMPHVLAEYPDFFALALVLLLTGLL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tsc22d2 Mouse Gene Knockout Kit (CRISPR)
KN518323 1 Kit

Tsc22d2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MAGE 1 (MAGEA1) Human Gene Knockout Kit (CRISPR)
KN202134 1 Kit

MAGE 1 (MAGEA1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse CDNF Protein, His Tag (MALS verified)
CDF-M52H3-500ug 500 µg

Mouse CDNF Protein, His Tag (MALS verified)

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS802247 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
MCAM (Melanoma Cell Adhesion Molecule) / MUC18 / CD146 (MCAM/3179), CF740 conjugate, 0.1mg/mL
BNC743179-500 1x 500 µL

MCAM (Melanoma Cell Adhesion Molecule) / MUC18 / CD146 (MCAM/3179), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IRX2 Rabbit Polyclonal Antibody
R1307-5 100 µL

IRX2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details