Slc7a3 Peptide - middle region
Slc7a3 Peptide - middle region
Product Specifications
Product Name Alternative
Atrc3, CAT3, SLC7A1, SLC7A2
UniProt
P70423
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Slc7a3 Rabbit Polyclonal Antibody (orb578935) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_031541
Preservative
Lyophilized powder
AA Sequence
RAWSSAFDNLIGNHISRTLKGTILLKMPHVLAEYPDFFALALVLLLTGLL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![TTF1 (NKX2-1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3E2]](https://cdn.genprice.uk/products/937/6868c3bb994c49e6dc3fd243/imageurl/ta803281am.webp)
TA803281AM 100 µL
TTF1 (NKX2-1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3E2]
Sign In for Pricing
View Details 
PKSM041331-01 10 µg
Recombinant Mouse ICOS Ligand/ICOSL Protein (His Tag)
Sign In for Pricing
View Details PKSM041331-02 50 µg
Recombinant Mouse ICOS Ligand/ICOSL Protein (His Tag)
Sign In for Pricing
View Details 