Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC7A7 Peptide - middle region

SLC7A7 Peptide - middle region

Product Specifications

Product Name Alternative

LAT3, LPI, Y+LAT1, y+LAT-1, MOP-2

UniProt

Q9UM01

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC7A7 Rabbit Polyclonal Antibody (orb325097) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003973

Preservative

Lyophilized powder

AA Sequence

WGTLVQDIFTYAKVLALIGIVRLGQGASTHFENSFEGSSFAVGDI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Menin (MEN1, Multiple Endocrine Neoplasia I, MEAI, SCG2, Wermer Syndrome, Zollinger Ellison Syndrome, ZES) (MaxLight 650)
MBS6487742-01 0.1 mL

Menin (MEN1, Multiple Endocrine Neoplasia I, MEAI, SCG2, Wermer Syndrome, Zollinger Ellison Syndrome, ZES) (MaxLight 650)

Sign In for Pricing
View Details
Menin (MEN1, Multiple Endocrine Neoplasia I, MEAI, SCG2, Wermer Syndrome, Zollinger Ellison Syndrome, ZES) (MaxLight 650)
MBS6487742-02 5x 0.1 mL

Menin (MEN1, Multiple Endocrine Neoplasia I, MEAI, SCG2, Wermer Syndrome, Zollinger Ellison Syndrome, ZES) (MaxLight 650)

Sign In for Pricing
View Details
Human Interleukin 6 CLIA Kit
IHUIL6KTC 1 Each

Human Interleukin 6 CLIA Kit

Sign In for Pricing
View Details
Hsa-miR-3609 agomir
HY-R00725A-01 5 nmol

Hsa-miR-3609 agomir

Sign In for Pricing
View Details
Hsa-miR-3609 agomir
HY-R00725A-02 20 nmol

Hsa-miR-3609 agomir

Sign In for Pricing
View Details
SGTA (NM_003021) Human Recombinant Protein
PROTO43765 20 µg

SGTA (NM_003021) Human Recombinant Protein

Sign In for Pricing
View Details