SLC7A7 Peptide - middle region
SLC7A7 Peptide - middle region
Product Specifications
Product Name Alternative
LAT3, LPI, Y+LAT1, y+LAT-1, MOP-2
UniProt
Q9UM01
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SLC7A7 Rabbit Polyclonal Antibody (orb325097) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_003973
Preservative
Lyophilized powder
AA Sequence
WGTLVQDIFTYAKVLALIGIVRLGQGASTHFENSFEGSSFAVGDI
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6487742-01 0.1 mL
Menin (MEN1, Multiple Endocrine Neoplasia I, MEAI, SCG2, Wermer Syndrome, Zollinger Ellison Syndrome, ZES) (MaxLight 650)
Sign In for Pricing
View Details MBS6487742-02 5x 0.1 mL
Menin (MEN1, Multiple Endocrine Neoplasia I, MEAI, SCG2, Wermer Syndrome, Zollinger Ellison Syndrome, ZES) (MaxLight 650)
Sign In for Pricing
View Details 
