Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC7A7 Peptide - middle region

SLC7A7 Peptide - middle region

Product Specifications

Product Name Alternative

LAT3, LPI, Y+LAT1, y+LAT-1, MOP-2

UniProt

Q9UM01

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC7A7 Rabbit Polyclonal Antibody (orb325097) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003973

Preservative

Lyophilized powder

AA Sequence

WGTLVQDIFTYAKVLALIGIVRLGQGASTHFENSFEGSSFAVGDI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Benzo[b]thiophene-2-carbonyl chloride
OR23167-01 1 g

Benzo[b]thiophene-2-carbonyl chloride

Sign In for Pricing
View Details
Benzo[b]thiophene-2-carbonyl chloride
OR23167-02 5 g

Benzo[b]thiophene-2-carbonyl chloride

Sign In for Pricing
View Details
Benzo[b]thiophene-2-carbonyl chloride
OR23167-03 25 g

Benzo[b]thiophene-2-carbonyl chloride

Sign In for Pricing
View Details
Benzo[b]thiophene-2-carbonyl chloride
OR23167-04 100 g

Benzo[b]thiophene-2-carbonyl chloride

Sign In for Pricing
View Details
Myozenin 3 CRISPR Activation Plasmid (m)
sc-431346-ACT 20 µg

Myozenin 3 CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
SDOS (NUDT16L1) (NM_032349) Human Over-expression Lysate
E45H12761-2 20 µg

SDOS (NUDT16L1) (NM_032349) Human Over-expression Lysate

Sign In for Pricing
View Details