Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC9A3 Peptide - middle region

SLC9A3 Peptide - middle region

Product Specifications

Product Name Alternative

MGC126718, MGC126720, NHE3

UniProt

P48764

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC9A3 Rabbit Polyclonal Antibody (orb330345) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004165

Preservative

Lyophilized powder

AA Sequence

AEDMVTHHTLQQYLYKPRQEYKHLYSRHELTPTEDEKQDREIFHRTMRKR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Macrophage Inflammatory Protein-1alpha Protein
OPRB00021-100UG 100 µg

Macrophage Inflammatory Protein-1alpha Protein

Sign In for Pricing
View Details
IL-33, Recombinant, Human (Interleukin-33, IL-1F11, NF-HEV)
044931 10 µg

IL-33, Recombinant, Human (Interleukin-33, IL-1F11, NF-HEV)

Sign In for Pricing
View Details
Recombinant Rat Tenascin C (TNC)
RPU43969-01 50 µg

Recombinant Rat Tenascin C (TNC)

Sign In for Pricing
View Details
Recombinant Rat Tenascin C (TNC)
RPU43969-02 100 µg

Recombinant Rat Tenascin C (TNC)

Sign In for Pricing
View Details
Recombinant Rat Tenascin C (TNC)
RPU43969-03 1 mg

Recombinant Rat Tenascin C (TNC)

Sign In for Pricing
View Details
Rat Pancreatic prohormone, PPY ELISA KIT
E2191Ra-01 48 Well

Rat Pancreatic prohormone, PPY ELISA KIT

Sign In for Pricing
View Details