Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Slc9a3r2 Peptide - C-terminal region

Slc9a3r2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

0610011L07Rik, 1200011K07Rik, 2010007A20Rik, E3karp, NHERF-2, Octs2, Sip-1, Sip1, Sryip1, Tka-1

UniProt

Q9JHL1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Slc9a3r2 Rabbit Polyclonal Antibody (orb330347) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_075938

Preservative

Lyophilized powder

AA Sequence

HFKRLRVIPTEEHVEGPLPSPVTNGTSPAQLNGGSVCSSRSDLPGSEKDN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

INSM1 (NM_002196) Human Recombinant Protein
TP315007 20 µg

INSM1 (NM_002196) Human Recombinant Protein

Sign In for Pricing
View Details
Histone 1F0 Antibody
8C10293-AAT 50 µg

Histone 1F0 Antibody

Sign In for Pricing
View Details
Anti-CD278 (7E.17G9) In Vivo Antibody - Low Endotoxin
ICH1082-50mg 50 mg

Anti-CD278 (7E.17G9) In Vivo Antibody - Low Endotoxin

Sign In for Pricing
View Details
Macrophage Scavenger Receptor I (MSR1) (NM_002445) Human Recombinant Protein
TP312931 20 µg

Macrophage Scavenger Receptor I (MSR1) (NM_002445) Human Recombinant Protein

Sign In for Pricing
View Details
Snrnp25 (NM_030093) Mouse Tagged ORF Clone
MG200616 10 µg

Snrnp25 (NM_030093) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Frozen Tissue Sections, Uterus
CS509984 5x 5 µm

Frozen Tissue Sections, Uterus

Sign In for Pricing
View Details