Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Slc9a3r2 Peptide - C-terminal region

Slc9a3r2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

0610011L07Rik, 1200011K07Rik, 2010007A20Rik, E3karp, NHERF-2, Octs2, Sip-1, Sip1, Sryip1, Tka-1

UniProt

Q9JHL1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Slc9a3r2 Rabbit Polyclonal Antibody (orb330347) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_075938

Preservative

Lyophilized powder

AA Sequence

HFKRLRVIPTEEHVEGPLPSPVTNGTSPAQLNGGSVCSSRSDLPGSEKDN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sirt1 Mouse Gene Knockout Kit (CRISPR)
KN515801 1 Kit

Sirt1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GLUT-1 (Tumor Progression and Mesothelioma Marker) (rGLUT1/2476), CF647 conjugate, 0.1mg/mL
BNC473795-100 1x 100 µL

GLUT-1 (Tumor Progression and Mesothelioma Marker) (rGLUT1/2476), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ENaC beta Antibody: HRP
SMC-241D-HRP 100 µg

ENaC beta Antibody: HRP

Sign In for Pricing
View Details
XIAP Antibody (Biotin)
KB-3637-01 50 μL

XIAP Antibody (Biotin)

Sign In for Pricing
View Details
XIAP Antibody (Biotin)
KB-3637-02 100 µL

XIAP Antibody (Biotin)

Sign In for Pricing
View Details
XIAP Antibody (Biotin)
KB-3637-03 1 mL

XIAP Antibody (Biotin)

Sign In for Pricing
View Details