Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Slc9a5 Peptide - C-terminal region

Slc9a5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Gm696

UniProt

B2RXE2

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Slc9a5 Rabbit Polyclonal Antibody (orb578973) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001074801

Preservative

Lyophilized powder

AA Sequence

SFAFPPSLAKAGRSRSESSADIPQQELQPLMGHKDHTHLSPGTANSHWCI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human COMMD1 activation kit by CRISPRa
GA115762 1 Kit

Human COMMD1 activation kit by CRISPRa

Sign In for Pricing
View Details
beta Actin (ACTB) (NM_001101) Human Over-expression Lysate
LC420311 20 µg

beta Actin (ACTB) (NM_001101) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS803361 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Cyanidin Chloride
TRC-C953645-1MG 1 mg

Cyanidin Chloride

Sign In for Pricing
View Details
PDE4C (NM_001098819) Human Over-expression Lysate
LC426049 20 µg

PDE4C (NM_001098819) Human Over-expression Lysate

Sign In for Pricing
View Details
Human MAGEB10 activation kit by CRISPRa
GA115341 1 Kit

Human MAGEB10 activation kit by CRISPRa

Sign In for Pricing
View Details