Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Slc9a5 Peptide - C-terminal region

Slc9a5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Gm696

UniProt

B2RXE2

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Slc9a5 Rabbit Polyclonal Antibody (orb578973) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001074801

Preservative

Lyophilized powder

AA Sequence

SFAFPPSLAKAGRSRSESSADIPQQELQPLMGHKDHTHLSPGTANSHWCI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Thiocytidine
TRC-T344418-5MG 5 mg

2-Thiocytidine

Sign In for Pricing
View Details
Dipeptidyl Peptidase IV (DPP4) Inhibitor Screening Assay Kit
E-BC-D007 96 Tests

Dipeptidyl Peptidase IV (DPP4) Inhibitor Screening Assay Kit

Sign In for Pricing
View Details
CD14 (Monocyte / Macrophage Marker) (LPSR/2397), CF594 conjugate, 0.1mg/mL
BNC942397-100 1x 100 µL

CD14 (Monocyte / Macrophage Marker) (LPSR/2397), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HENMT1 Human Gene Knockout Kit (CRISPR)
KN401373 1 Kit

HENMT1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SNRPB (N-term) Rabbit Polyclonal Antibody
AP18203PU-N 400 µL

SNRPB (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
D Amino Acid Oxidase (DAO) (NM_001917) Human Over-expression Lysate
LC419652 20 µg

D Amino Acid Oxidase (DAO) (NM_001917) Human Over-expression Lysate

Sign In for Pricing
View Details