Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Smad4 Peptide - middle region

Smad4 Peptide - middle region

Product Specifications

Product Name Alternative

AW743858, D18Wsu70e, DPC4, Madh4

UniProt

P97471

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Smad4 Rabbit Polyclonal Antibody (orb574335) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_032566

Preservative

Lyophilized powder

AA Sequence

YVHDFEGQPSLPTEGHSIQTIQHPPSNRASTETYSAPALLAPAESNATST

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SHP-1 Antibody
MBS9504337-01 0.05 mL

SHP-1 Antibody

Sign In for Pricing
View Details
SHP-1 Antibody
MBS9504337-02 0.1 mL

SHP-1 Antibody

Sign In for Pricing
View Details
SHP-1 Antibody
MBS9504337-03 5x 0.1 mL

SHP-1 Antibody

Sign In for Pricing
View Details
Cardiac Troponin I (Biotin)
545684 200 µL

Cardiac Troponin I (Biotin)

Sign In for Pricing
View Details
DPEP2 (Dipeptidase 2, DPEP2) (PE) discontinued
302394-PE 100 µL

DPEP2 (Dipeptidase 2, DPEP2) (PE) discontinued

Sign In for Pricing
View Details
Thada ORF Vector (Rat) (pORF)
ORF077662 1.0 µg DNA

Thada ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details