Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Smad4 Peptide - middle region

Smad4 Peptide - middle region

Product Specifications

Product Name Alternative

AW743858, D18Wsu70e, DPC4, Madh4

UniProt

P97471

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Smad4 Rabbit Polyclonal Antibody (orb574335) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_032566

Preservative

Lyophilized powder

AA Sequence

YVHDFEGQPSLPTEGHSIQTIQHPPSNRASTETYSAPALLAPAESNATST

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Usmg5 3'UTR GFP Stable Cell Line
TU272915 1.0 mL

Usmg5 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
IL36G Antibody
OACA08773-100UL 100 µL

IL36G Antibody

Sign In for Pricing
View Details
FAM19A3 sgRNA CRISPR Lentivector (Human) (Target 3)
K0716204 1.0 µg DNA

FAM19A3 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
VANGL2 Human shRNA Plasmid Kit (Locus ID 57216)
TL300590 1 Kit

VANGL2 Human shRNA Plasmid Kit (Locus ID 57216)

Sign In for Pricing
View Details
Sheep Prefoldin subunit 6 (PFDN6) ELISA Kit
GTR10356295 96 Well

Sheep Prefoldin subunit 6 (PFDN6) ELISA Kit

Sign In for Pricing
View Details
TRNAA20 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K2474108 1.0 µg DNA

TRNAA20 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details