Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Smarcd3 Peptide - C-terminal region

Smarcd3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

1500001J14Rik, 2210409C08Rik, BAF60C

UniProt

Q6P9Z1

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Smarcd3 Rabbit Polyclonal Antibody (orb583958) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_080167

Preservative

Lyophilized powder

AA Sequence

DLKVMTDVAGNPEEERRAEFYHQPWSQEAVSRYFYCKIQQRRQELEQSLV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ciclesonide-d11 (Mixture of Diastereomers)
HY-W766409 1 Each

Ciclesonide-d11 (Mixture of Diastereomers)

Sign In for Pricing
View Details
HELZ Polyclonal Antibody
bs-15450R 100 µL

HELZ Polyclonal Antibody

Sign In for Pricing
View Details
IRF1 Recombinant Protein
OPCD04527-50UG 50 µg

IRF1 Recombinant Protein

Sign In for Pricing
View Details
Rat vesicular monamine transporter-2 (VMAT2) ELISA Kit
YP-W31214-01 48 Tests

Rat vesicular monamine transporter-2 (VMAT2) ELISA Kit

Sign In for Pricing
View Details
Rat vesicular monamine transporter-2 (VMAT2) ELISA Kit
YP-W31214-02 96 Tests

Rat vesicular monamine transporter-2 (VMAT2) ELISA Kit

Sign In for Pricing
View Details
TurboGFP Mouse mAb, BF750 conjugated
orb2367130 100 µL

TurboGFP Mouse mAb, BF750 conjugated

Sign In for Pricing
View Details