Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Smarcd3 Peptide - C-terminal region

Smarcd3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

1500001J14Rik, 2210409C08Rik, BAF60C

UniProt

Q6P9Z1

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Smarcd3 Rabbit Polyclonal Antibody (orb583958) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_080167

Preservative

Lyophilized powder

AA Sequence

DLKVMTDVAGNPEEERRAEFYHQPWSQEAVSRYFYCKIQQRRQELEQSLV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tcp11 (NM_013687) Mouse Tagged ORF Clone
MR223625 10 µg

Tcp11 (NM_013687) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Fargesin discontinued
371431 5 mg

Fargesin discontinued

Sign In for Pricing
View Details
Otk Antibody
orb807046 2 mg

Otk Antibody

Sign In for Pricing
View Details
Dhrsx Rat shRNA Lentiviral Particle (Locus ID 288525)
TL704509V 500 µL Each

Dhrsx Rat shRNA Lentiviral Particle (Locus ID 288525)

Sign In for Pricing
View Details
Fam89b (NM_001015013) Rat Tagged ORF Clone Lentiviral Particle
RR213898L3V 200 µL

Fam89b (NM_001015013) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
5- (Dimethoxymethyl) picolinaldehyde
OR1067368-01 1 g

5- (Dimethoxymethyl) picolinaldehyde

Sign In for Pricing
View Details