Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPP4R3A Peptide - middle region

PPP4R3A Peptide - middle region

Product Specifications

Product Name Alternative

Smk1, FLFL1, PP4R3, SMEK1, smk-1, PP4R3A, MSTP033, KIAA2010

UniProt

Q6IN85

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PPP4R3A Rabbit Polyclonal Antibody (orb583667) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115949

Preservative

Lyophilized powder

AA Sequence

YWKALEDVDYVQTFKGLKLRFEQQRERQDNPKLDSMRSILRNHRYRRDAR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal NALP6 Antibody (920631) [FITC]
FAB9145F 0.1 mL

Mouse Monoclonal NALP6 Antibody (920631) [FITC]

Sign In for Pricing
View Details
Recombinant Herminiimonas arsenicoxydans Probable Fe (2+)-trafficking protein
MBS1212438-01 0.02 mg (E-Coli)

Recombinant Herminiimonas arsenicoxydans Probable Fe (2+)-trafficking protein

Sign In for Pricing
View Details
Recombinant Herminiimonas arsenicoxydans Probable Fe (2+)-trafficking protein
MBS1212438-02 0.1 mg (E-Coli)

Recombinant Herminiimonas arsenicoxydans Probable Fe (2+)-trafficking protein

Sign In for Pricing
View Details
Recombinant Herminiimonas arsenicoxydans Probable Fe (2+)-trafficking protein
MBS1212438-03 0.02 mg (Yeast)

Recombinant Herminiimonas arsenicoxydans Probable Fe (2+)-trafficking protein

Sign In for Pricing
View Details
Recombinant Herminiimonas arsenicoxydans Probable Fe (2+)-trafficking protein
MBS1212438-04 0.1 mg (Yeast)

Recombinant Herminiimonas arsenicoxydans Probable Fe (2+)-trafficking protein

Sign In for Pricing
View Details
Recombinant Herminiimonas arsenicoxydans Probable Fe (2+)-trafficking protein
MBS1212438-05 0.02 mg (Baculovirus)

Recombinant Herminiimonas arsenicoxydans Probable Fe (2+)-trafficking protein

Sign In for Pricing
View Details