PPP4R3A Peptide - middle region
PPP4R3A Peptide - middle region
Product Specifications
Product Name Alternative
Smk1, FLFL1, PP4R3, SMEK1, smk-1, PP4R3A, MSTP033, KIAA2010
UniProt
Q6IN85
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PPP4R3A Rabbit Polyclonal Antibody (orb583667) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_115949
Preservative
Lyophilized powder
AA Sequence
YWKALEDVDYVQTFKGLKLRFEQQRERQDNPKLDSMRSILRNHRYRRDAR
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MAB12135-100 1 Each
Mouse monoclonal antibody specific for Dengue virus serotype 2 (clone ME1)
Sign In for Pricing
View Details 48874061 1.0 µg DNA
TXNDC3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
Sign In for Pricing
View Details 
MBS2062875-01 0.1 mL
APC-Linked Polyclonal Antibody to Laminin Beta 3 (LAMb3)
Sign In for Pricing
View Details