Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPP4R3B Peptide - C-terminal region

PPP4R3B Peptide - C-terminal region

Product Specifications

Product Name Alternative

Smek2, AW011752, AW557776, mKIAA1387

UniProt

Q922R5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PPP4R3B Rabbit Polyclonal Antibody (orb583562) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_598795

Preservative

Lyophilized powder

AA Sequence

DSYEKFMETKKAKESEDKENLPKRASSGGFKFTFSHSPSATNGTNSTNSK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Alpha-Amylase Inhibitor Screening Kit
E-BC-D018-01 48 Tests

Alpha-Amylase Inhibitor Screening Kit

Sign In for Pricing
View Details
Alpha-Amylase Inhibitor Screening Kit
E-BC-D018-02 96 Tests

Alpha-Amylase Inhibitor Screening Kit

Sign In for Pricing
View Details
MCAM / MUC18 / Mucin 18 / CD146 (MCAM/1101), CF488A conjugate, 0.1mg/mL
BNC881101-500 1x 500 µL

MCAM / MUC18 / Mucin 18 / CD146 (MCAM/1101), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
RFC5 antibody
FNab07251 100 µg

RFC5 antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Adrenal gland
CS716276 5x 5 µm

Tissue FFPE Sections, Adrenal gland

Sign In for Pricing
View Details
Frozen Tissue Sections, Renal pelvis
CS500132 5x 5 µm

Frozen Tissue Sections, Renal pelvis

Sign In for Pricing
View Details